Brand: | Abnova |
Reference: | H00063924-M07 |
Product name: | CIDEC monoclonal antibody (M07), clone 2E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CIDEC. |
Clone: | 2E2 |
Isotype: | IgG1 Kappa |
Gene id: | 63924 |
Gene name: | CIDEC |
Gene alias: | CIDE-3|FLJ20871|Fsp27 |
Gene description: | cell death-inducing DFFA-like effector c |
Genbank accession: | NM_022094 |
Immunogen: | CIDEC (NP_071377.2, 53 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA |
Protein accession: | NP_071377.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CIDEC is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Erythropoietin does not activate erythropoietin receptor signaling or lipolytic pathways in human subcutaneous white adipose tissue in vivo.Christensen B, Nellemann B, Jorgensen JO, Pedersen SB, Jessen N. Lipids Health Dis. 2016 Sep 17;15(1):160. |