CIDEC monoclonal antibody (M07), clone 2E2 View larger

CIDEC monoclonal antibody (M07), clone 2E2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIDEC monoclonal antibody (M07), clone 2E2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CIDEC monoclonal antibody (M07), clone 2E2

Brand: Abnova
Reference: H00063924-M07
Product name: CIDEC monoclonal antibody (M07), clone 2E2
Product description: Mouse monoclonal antibody raised against a partial recombinant CIDEC.
Clone: 2E2
Isotype: IgG1 Kappa
Gene id: 63924
Gene name: CIDEC
Gene alias: CIDE-3|FLJ20871|Fsp27
Gene description: cell death-inducing DFFA-like effector c
Genbank accession: NM_022094
Immunogen: CIDEC (NP_071377.2, 53 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
Protein accession: NP_071377.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00063924-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00063924-M07-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CIDEC is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Erythropoietin does not activate erythropoietin receptor signaling or lipolytic pathways in human subcutaneous white adipose tissue in vivo.Christensen B, Nellemann B, Jorgensen JO, Pedersen SB, Jessen N.
Lipids Health Dis. 2016 Sep 17;15(1):160.

Reviews

Buy CIDEC monoclonal antibody (M07), clone 2E2 now

Add to cart