CIDEC purified MaxPab mouse polyclonal antibody (B02P) View larger

CIDEC purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIDEC purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CIDEC purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00063924-B02P
Product name: CIDEC purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human CIDEC protein.
Gene id: 63924
Gene name: CIDEC
Gene alias: CIDE-3|FLJ20871|Fsp27
Gene description: cell death-inducing DFFA-like effector c
Genbank accession: NM_022094
Immunogen: CIDEC (NP_071377.2, 1 a.a. ~ 238 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
Protein accession: NP_071377.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00063924-B02P-13-15-1.jpg
Application image note: Western Blot analysis of CIDEC expression in transfected 293T cell line (H00063924-T02) by CIDEC MaxPab polyclonal antibody.

Lane 1: CIDEC transfected lysate(26.18 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CIDEC purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart