Brand: | Abnova |
Reference: | H00063916-M07 |
Product name: | ELMO2 monoclonal antibody (M07), clone 2E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ELMO2. |
Clone: | 2E5 |
Isotype: | IgG2a Kappa |
Gene id: | 63916 |
Gene name: | ELMO2 |
Gene alias: | CED-12|CED12|ELMO-2|FLJ11656|KIAA1834 |
Gene description: | engulfment and cell motility 2 |
Genbank accession: | NM_133171 |
Immunogen: | ELMO2 (NP_573403.1, 89 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQPMVDVS |
Protein accession: | NP_573403.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |