ELMO2 monoclonal antibody (M07), clone 2E5 View larger

ELMO2 monoclonal antibody (M07), clone 2E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELMO2 monoclonal antibody (M07), clone 2E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ELMO2 monoclonal antibody (M07), clone 2E5

Brand: Abnova
Reference: H00063916-M07
Product name: ELMO2 monoclonal antibody (M07), clone 2E5
Product description: Mouse monoclonal antibody raised against a partial recombinant ELMO2.
Clone: 2E5
Isotype: IgG2a Kappa
Gene id: 63916
Gene name: ELMO2
Gene alias: CED-12|CED12|ELMO-2|FLJ11656|KIAA1834
Gene description: engulfment and cell motility 2
Genbank accession: NM_133171
Immunogen: ELMO2 (NP_573403.1, 89 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQPMVDVS
Protein accession: NP_573403.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy ELMO2 monoclonal antibody (M07), clone 2E5 now

Add to cart