ELMO2 monoclonal antibody (M02), clone 3G7 View larger

ELMO2 monoclonal antibody (M02), clone 3G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELMO2 monoclonal antibody (M02), clone 3G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ELMO2 monoclonal antibody (M02), clone 3G7

Brand: Abnova
Reference: H00063916-M02
Product name: ELMO2 monoclonal antibody (M02), clone 3G7
Product description: Mouse monoclonal antibody raised against a partial recombinant ELMO2.
Clone: 3G7
Isotype: IgG2b Kappa
Gene id: 63916
Gene name: ELMO2
Gene alias: CED-12|CED12|ELMO-2|FLJ11656|KIAA1834
Gene description: engulfment and cell motility 2
Genbank accession: NM_133171
Immunogen: ELMO2 (NP_573403.1, 89 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQPMVDVS
Protein accession: NP_573403.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00063916-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ELMO2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ELMO2 monoclonal antibody (M02), clone 3G7 now

Add to cart