DUSP21 purified MaxPab mouse polyclonal antibody (B01P) View larger

DUSP21 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP21 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about DUSP21 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00063904-B01P
Product name: DUSP21 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human DUSP21 protein.
Gene id: 63904
Gene name: DUSP21
Gene alias: LMWDSP21|MGC149878
Gene description: dual specificity phosphatase 21
Genbank accession: NM_022076.2
Immunogen: DUSP21 (NP_071359.2, 1 a.a. ~ 190 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTASASSFSSSQGVQQPSIYSFSQITRSLFLSNGVAANDKLLLSSNRITAIVNASVEVVNVFFEGIQYIKVPVTDARDSRLYDFFDPIADLIHTIDMRQGRTLLHCMAGVSRSASLCLAYLMKYHSMSLLDAHTWTKSRRPIIRPNNGFWEQLINYEFKLFNNNTVRMINSPVGNIPDIYEKDLRTMISM
Protein accession: NP_071359.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00063904-B01P-13-15-1.jpg
Application image note: Western Blot analysis of DUSP21 expression in transfected 293T cell line (H00063904-T01) by DUSP21 MaxPab polyclonal antibody.

Lane 1: DUSP21 transfected lysate(20.9 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DUSP21 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart