SH2D4A monoclonal antibody (M01), clone 3G8 View larger

SH2D4A monoclonal antibody (M01), clone 3G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH2D4A monoclonal antibody (M01), clone 3G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about SH2D4A monoclonal antibody (M01), clone 3G8

Brand: Abnova
Reference: H00063898-M01
Product name: SH2D4A monoclonal antibody (M01), clone 3G8
Product description: Mouse monoclonal antibody raised against a partial recombinant SH2D4A.
Clone: 3G8
Isotype: IgG2a Kappa
Gene id: 63898
Gene name: SH2D4A
Gene alias: FLJ20967|SH2A
Gene description: SH2 domain containing 4A
Genbank accession: BC014525
Immunogen: SH2D4A (AAH14525, 239 a.a. ~ 338 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KKANELLLSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLIDASADAYSFLGVDQLQHATLADLVEYHKEEPITSLGKELLLYPCGQQDQLPDYLELFE
Protein accession: AAH14525
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00063898-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00063898-M01-3-1-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SH2D4A on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SH2D4A monoclonal antibody (M01), clone 3G8 now

Add to cart