UBE2O monoclonal antibody (M06), clone 2C10 View larger

UBE2O monoclonal antibody (M06), clone 2C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2O monoclonal antibody (M06), clone 2C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about UBE2O monoclonal antibody (M06), clone 2C10

Brand: Abnova
Reference: H00063893-M06
Product name: UBE2O monoclonal antibody (M06), clone 2C10
Product description: Mouse monoclonal antibody raised against a partial recombinant UBE2O.
Clone: 2C10
Isotype: IgG2a Kappa
Gene id: 63893
Gene name: UBE2O
Gene alias: E2-230K|FLJ12878|KIAA1734
Gene description: ubiquitin-conjugating enzyme E2O
Genbank accession: NM_022066
Immunogen: UBE2O (NP_071349.2, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VEPAKIAWECPEKNCAQGEGSMAKKVKRLLKKQVVRIMSCSPDTQCSRDHSMEDPDKKGESKTKSEAESASPEETPDGSASPVEMQDEGAEEPHEAGEQLPPFLLKEGRD
Protein accession: NP_071349.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00063893-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00063893-M06-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged UBE2O is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UBE2O monoclonal antibody (M06), clone 2C10 now

Add to cart