Brand: | Abnova |
Reference: | H00063893-M06 |
Product name: | UBE2O monoclonal antibody (M06), clone 2C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE2O. |
Clone: | 2C10 |
Isotype: | IgG2a Kappa |
Gene id: | 63893 |
Gene name: | UBE2O |
Gene alias: | E2-230K|FLJ12878|KIAA1734 |
Gene description: | ubiquitin-conjugating enzyme E2O |
Genbank accession: | NM_022066 |
Immunogen: | UBE2O (NP_071349.2, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VEPAKIAWECPEKNCAQGEGSMAKKVKRLLKKQVVRIMSCSPDTQCSRDHSMEDPDKKGESKTKSEAESASPEETPDGSASPVEMQDEGAEEPHEAGEQLPPFLLKEGRD |
Protein accession: | NP_071349.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged UBE2O is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |