RNF123 monoclonal antibody (M01), clone 3F8 View larger

RNF123 monoclonal antibody (M01), clone 3F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF123 monoclonal antibody (M01), clone 3F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about RNF123 monoclonal antibody (M01), clone 3F8

Brand: Abnova
Reference: H00063891-M01
Product name: RNF123 monoclonal antibody (M01), clone 3F8
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF123.
Clone: 3F8
Isotype: IgG1 Kappa
Gene id: 63891
Gene name: RNF123
Gene alias: DKFZp686C2222|FLJ12565|FP1477|KPC1|MGC163504
Gene description: ring finger protein 123
Genbank accession: NM_022064
Immunogen: RNF123 (NP_071347, 1216 a.a. ~ 1314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKGANTSTTSSAA
Protein accession: NP_071347
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00063891-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00063891-M01-1-1-1.jpg
Application image note: RNF123 monoclonal antibody (M01), clone 3F8 Western Blot analysis of RNF123 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Proteasomes Can Degrade a Significant Proportion of Cellular Proteins Independent of Ubiquitination.Baugh JM, Viktorova EG, Pilipenko EV.
J Mol Biol. 2009 Feb 27;386(3):814-27. Epub 2009 Jan 8.

Reviews

Buy RNF123 monoclonal antibody (M01), clone 3F8 now

Add to cart