Brand: | Abnova |
Reference: | H00063891-M01 |
Product name: | RNF123 monoclonal antibody (M01), clone 3F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF123. |
Clone: | 3F8 |
Isotype: | IgG1 Kappa |
Gene id: | 63891 |
Gene name: | RNF123 |
Gene alias: | DKFZp686C2222|FLJ12565|FP1477|KPC1|MGC163504 |
Gene description: | ring finger protein 123 |
Genbank accession: | NM_022064 |
Immunogen: | RNF123 (NP_071347, 1216 a.a. ~ 1314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKGANTSTTSSAA |
Protein accession: | NP_071347 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RNF123 monoclonal antibody (M01), clone 3F8 Western Blot analysis of RNF123 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Proteasomes Can Degrade a Significant Proportion of Cellular Proteins Independent of Ubiquitination.Baugh JM, Viktorova EG, Pilipenko EV. J Mol Biol. 2009 Feb 27;386(3):814-27. Epub 2009 Jan 8. |