PKNOX2 monoclonal antibody (M01), clone 4B6 View larger

PKNOX2 monoclonal antibody (M01), clone 4B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PKNOX2 monoclonal antibody (M01), clone 4B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about PKNOX2 monoclonal antibody (M01), clone 4B6

Brand: Abnova
Reference: H00063876-M01
Product name: PKNOX2 monoclonal antibody (M01), clone 4B6
Product description: Mouse monoclonal antibody raised against a partial recombinant PKNOX2.
Clone: 4B6
Isotype: IgG2b Kappa
Gene id: 63876
Gene name: PKNOX2
Gene alias: FLJ13074|PREP2
Gene description: PBX/knotted 1 homeobox 2
Genbank accession: NM_022062
Immunogen: PKNOX2 (NP_071345, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCFKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGN
Protein accession: NP_071345
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00063876-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00063876-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to PKNOX2 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy PKNOX2 monoclonal antibody (M01), clone 4B6 now

Add to cart