Brand: | Abnova |
Reference: | H00063826-D01 |
Product name: | SRR MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human SRR protein. |
Gene id: | 63826 |
Gene name: | SRR |
Gene alias: | ILV1|ISO1 |
Gene description: | serine racemase |
Genbank accession: | NM_021947.1 |
Immunogen: | SRR (NP_068766.1, 1 a.a. ~ 340 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV |
Protein accession: | NP_068766.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of SRR transfected lysate using anti-SRR MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SRR MaxPab mouse polyclonal antibody (B01) (H00063826-B01). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |