Brand: | Abnova |
Reference: | H00060685-M03 |
Product name: | ZFAND3 monoclonal antibody (M03), clone 2D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZFAND3. |
Clone: | 2D2 |
Isotype: | IgG1 Kappa |
Gene id: | 60685 |
Gene name: | ZFAND3 |
Gene alias: | FLJ13222|FLJ17799|TEX27 |
Gene description: | zinc finger, AN1-type domain 3 |
Genbank accession: | NM_021943 |
Immunogen: | ZFAND3 (NP_068762.1, 2 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLF |
Protein accession: | NP_068762.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.23 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |