ZFAND3 monoclonal antibody (M03), clone 2D2 View larger

ZFAND3 monoclonal antibody (M03), clone 2D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZFAND3 monoclonal antibody (M03), clone 2D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ZFAND3 monoclonal antibody (M03), clone 2D2

Brand: Abnova
Reference: H00060685-M03
Product name: ZFAND3 monoclonal antibody (M03), clone 2D2
Product description: Mouse monoclonal antibody raised against a partial recombinant ZFAND3.
Clone: 2D2
Isotype: IgG1 Kappa
Gene id: 60685
Gene name: ZFAND3
Gene alias: FLJ13222|FLJ17799|TEX27
Gene description: zinc finger, AN1-type domain 3
Genbank accession: NM_021943
Immunogen: ZFAND3 (NP_068762.1, 2 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLF
Protein accession: NP_068762.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060685-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.23 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZFAND3 monoclonal antibody (M03), clone 2D2 now

Add to cart