Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FKBP10 monoclonal antibody (M13), clone 2D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about FKBP10 monoclonal antibody (M13), clone 2D4
| Brand: | Abnova |
| Reference: | H00060681-M13 |
| Product name: | FKBP10 monoclonal antibody (M13), clone 2D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FKBP10. |
| Clone: | 2D4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 60681 |
| Gene name: | FKBP10 |
| Gene alias: | FKBP6|FKBP65|FLJ20683|FLJ22041|FLJ23833|hFKBP65 |
| Gene description: | FK506 binding protein 10, 65 kDa |
| Genbank accession: | NM_021939 |
| Immunogen: | FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV |
| Protein accession: | NP_068758 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FKBP10 monoclonal antibody (M13), clone 2D4. Western Blot analysis of FKBP10 expression in HepG2(Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A novel splicing mutation in FKBP10 causing osteogenesis imperfecta with a possible mineralization defect.Venturi G, Monti E, Carbonare LD, Corradi M, Gandini A, Valenti MT, Boner A, Antoniazzi F. Bone. 2011 Oct 30. |