FKBP10 monoclonal antibody (M02), clone 3B5 View larger

FKBP10 monoclonal antibody (M02), clone 3B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FKBP10 monoclonal antibody (M02), clone 3B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FKBP10 monoclonal antibody (M02), clone 3B5

Brand: Abnova
Reference: H00060681-M02
Product name: FKBP10 monoclonal antibody (M02), clone 3B5
Product description: Mouse monoclonal antibody raised against a partial recombinant FKBP10.
Clone: 3B5
Isotype: IgG2a Kappa
Gene id: 60681
Gene name: FKBP10
Gene alias: FKBP6|FKBP65|FLJ20683|FLJ22041|FLJ23833|hFKBP65
Gene description: FK506 binding protein 10, 65 kDa
Genbank accession: NM_021939
Immunogen: FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV
Protein accession: NP_068758
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060681-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060681-M02-1-12-1.jpg
Application image note: FKBP10 monoclonal antibody (M02), clone 3B5. Western Blot analysis of FKBP10 expression in HepG2(Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: A novel splicing mutation in FKBP10 causing osteogenesis imperfecta with a possible mineralization defect.Venturi G, Monti E, Carbonare LD, Corradi M, Gandini A, Valenti MT, Boner A, Antoniazzi F.
Bone. 2011 Oct 30.

Reviews

Buy FKBP10 monoclonal antibody (M02), clone 3B5 now

Add to cart