Brand: | Abnova |
Reference: | H00060681-M01 |
Product name: | FKBP10 monoclonal antibody (M01), clone 1C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FKBP10. |
Clone: | 1C6 |
Isotype: | IgG2a Kappa |
Gene id: | 60681 |
Gene name: | FKBP10 |
Gene alias: | FKBP6|FKBP65|FLJ20683|FLJ22041|FLJ23833|hFKBP65 |
Gene description: | FK506 binding protein 10, 65 kDa |
Genbank accession: | NM_021939 |
Immunogen: | FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV |
Protein accession: | NP_068758 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FKBP10 monoclonal antibody (M01), clone 1C6 Western Blot analysis of FKBP10 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |