FKBP10 monoclonal antibody (M01), clone 1C6 View larger

FKBP10 monoclonal antibody (M01), clone 1C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FKBP10 monoclonal antibody (M01), clone 1C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FKBP10 monoclonal antibody (M01), clone 1C6

Brand: Abnova
Reference: H00060681-M01
Product name: FKBP10 monoclonal antibody (M01), clone 1C6
Product description: Mouse monoclonal antibody raised against a partial recombinant FKBP10.
Clone: 1C6
Isotype: IgG2a Kappa
Gene id: 60681
Gene name: FKBP10
Gene alias: FKBP6|FKBP65|FLJ20683|FLJ22041|FLJ23833|hFKBP65
Gene description: FK506 binding protein 10, 65 kDa
Genbank accession: NM_021939
Immunogen: FKBP10 (NP_068758, 377 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV
Protein accession: NP_068758
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060681-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060681-M01-1-1-1.jpg
Application image note: FKBP10 monoclonal antibody (M01), clone 1C6 Western Blot analysis of FKBP10 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FKBP10 monoclonal antibody (M01), clone 1C6 now

Add to cart