BRUNOL5 MaxPab mouse polyclonal antibody (B01) View larger

BRUNOL5 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BRUNOL5 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about BRUNOL5 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00060680-B01
Product name: BRUNOL5 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human BRUNOL5 protein.
Gene id: 60680
Gene name: BRUNOL5
Gene alias: BRUNOL-5|CELF5
Gene description: bruno-like 5, RNA binding protein (Drosophila)
Genbank accession: BC047522
Immunogen: BRUNOL5 (AAH47522, 1 a.a. ~ 402 a.a) full-length human protein.
Immunogen sequence/protein sequence: MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLLEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFSRWAPCPGNRLCQWPCALPSSEPDCGRDTASCLLRSPAVHSHVPHRGHHAHRAQRPPAAAPPAAAAARRSLETRS
Protein accession: AAH47522
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060680-B01-13-15-1.jpg
Application image note: Western Blot analysis of BRUNOL5 expression in transfected 293T cell line (H00060680-T01) by BRUNOL5 MaxPab polyclonal antibody.

Lane 1: BRUNOL5 transfected lysate(44.22 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BRUNOL5 MaxPab mouse polyclonal antibody (B01) now

Add to cart