RIC8A monoclonal antibody (M01), clone 1H6 View larger

RIC8A monoclonal antibody (M01), clone 1H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RIC8A monoclonal antibody (M01), clone 1H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about RIC8A monoclonal antibody (M01), clone 1H6

Brand: Abnova
Reference: H00060626-M01
Product name: RIC8A monoclonal antibody (M01), clone 1H6
Product description: Mouse monoclonal antibody raised against a partial recombinant RIC8A.
Clone: 1H6
Isotype: IgG2a Kappa
Gene id: 60626
Gene name: RIC8A
Gene alias: MGC104517|MGC131931|MGC148073|MGC148074|RIC8|synembryn
Gene description: resistance to inhibitors of cholinesterase 8 homolog A (C. elegans)
Genbank accession: NM_021932
Immunogen: RIC8A (NP_068751.4, 462 a.a. ~ 534 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDS
Protein accession: NP_068751.4
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060626-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060626-M01-1-9-1.jpg
Application image note: RIC8A monoclonal antibody (M01), clone 1H6. Western Blot analysis of RIC8A expression in K-562.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RIC8A monoclonal antibody (M01), clone 1H6 now

Add to cart