ELAC2 monoclonal antibody (M01), clone 1A2 View larger

ELAC2 monoclonal antibody (M01), clone 1A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELAC2 monoclonal antibody (M01), clone 1A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about ELAC2 monoclonal antibody (M01), clone 1A2

Brand: Abnova
Reference: H00060528-M01
Product name: ELAC2 monoclonal antibody (M01), clone 1A2
Product description: Mouse monoclonal antibody raised against a partial recombinant ELAC2.
Clone: 1A2
Isotype: IgG2a Kappa
Gene id: 60528
Gene name: ELAC2
Gene alias: ELC2|FLJ10530|FLJ36693|FLJ42848|HPC2
Gene description: elaC homolog 2 (E. coli)
Genbank accession: NM_018127
Immunogen: ELAC2 (NP_060597.3, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WALCSLLRSAAGRTMSQGRTISQAPARRERPRKDPLRHLRTREKRGPSGCSGGPNTVYLQVVAAGSRDSGAALYVFSEFNRYLFNCGEGVQRLMQEHKL
Protein accession: NP_060597.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060528-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ELAC2 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy ELAC2 monoclonal antibody (M01), clone 1A2 now

Add to cart