Brand: | Abnova |
Reference: | H00060528-M01 |
Product name: | ELAC2 monoclonal antibody (M01), clone 1A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ELAC2. |
Clone: | 1A2 |
Isotype: | IgG2a Kappa |
Gene id: | 60528 |
Gene name: | ELAC2 |
Gene alias: | ELC2|FLJ10530|FLJ36693|FLJ42848|HPC2 |
Gene description: | elaC homolog 2 (E. coli) |
Genbank accession: | NM_018127 |
Immunogen: | ELAC2 (NP_060597.3, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WALCSLLRSAAGRTMSQGRTISQAPARRERPRKDPLRHLRTREKRGPSGCSGGPNTVYLQVVAAGSRDSGAALYVFSEFNRYLFNCGEGVQRLMQEHKL |
Protein accession: | NP_060597.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to ELAC2 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA |
Shipping condition: | Dry Ice |