AASDHPPT monoclonal antibody (M01), clone 2C12 View larger

AASDHPPT monoclonal antibody (M01), clone 2C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AASDHPPT monoclonal antibody (M01), clone 2C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Tr

More info about AASDHPPT monoclonal antibody (M01), clone 2C12

Brand: Abnova
Reference: H00060496-M01
Product name: AASDHPPT monoclonal antibody (M01), clone 2C12
Product description: Mouse monoclonal antibody raised against a full-length recombinant AASDHPPT.
Clone: 2C12
Isotype: IgG1 Kappa
Gene id: 60496
Gene name: AASDHPPT
Gene alias: AASD-PPT|CGI-80|DKFZp566E2346|LYS2|LYS5
Gene description: aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Genbank accession: BC015470
Immunogen: AASDHPPT (AAH15470, 1 a.a. ~ 309 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTARGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGAGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Protein accession: AAH15470
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060496-M01-13-15-1.jpg
Application image note: Western Blot analysis of AASDHPPT expression in transfected 293T cell line by AASDHPPT monoclonal antibody (M01), clone 2C12.

Lane 1: AASDHPPT transfected lysate (Predicted MW: 35.8 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AASDHPPT monoclonal antibody (M01), clone 2C12 now

Add to cart