Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00060496-M01 |
Product name: | AASDHPPT monoclonal antibody (M01), clone 2C12 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant AASDHPPT. |
Clone: | 2C12 |
Isotype: | IgG1 Kappa |
Gene id: | 60496 |
Gene name: | AASDHPPT |
Gene alias: | AASD-PPT|CGI-80|DKFZp566E2346|LYS2|LYS5 |
Gene description: | aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase |
Genbank accession: | BC015470 |
Immunogen: | AASDHPPT (AAH15470, 1 a.a. ~ 309 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTARGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGAGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS |
Protein accession: | AAH15470 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of AASDHPPT expression in transfected 293T cell line by AASDHPPT monoclonal antibody (M01), clone 2C12. Lane 1: AASDHPPT transfected lysate (Predicted MW: 35.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Tr |
Shipping condition: | Dry Ice |