Cart 136 Product Products 51 268,80 € (empty)
No products
265,00 € DAP Shipping
51 533,80 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 136 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 51 268,80 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 51 533,80 €
Data sheet of AASDHPPT purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
More info about AASDHPPT purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00060496-B01P |
| Product name: | AASDHPPT purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human AASDHPPT protein. |
| Gene id: | 60496 |
| Gene name: | AASDHPPT |
| Gene alias: | AASD-PPT|CGI-80|DKFZp566E2346|LYS2|LYS5 |
| Gene description: | aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase |
| Genbank accession: | NM_015423.2 |
| Immunogen: | AASDHPPT (NP_056238.2, 1 a.a. ~ 309 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS |
| Protein accession: | NP_056238.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Western Blot analysis of AASDHPPT expression in transfected 293T cell line (H00060496-T01) by AASDHPPT MaxPab polyclonal antibody. Lane 1: AASDHPPT transfected lysate(33.99 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |