AASDHPPT MaxPab mouse polyclonal antibody (B01) View larger

AASDHPPT MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AASDHPPT MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about AASDHPPT MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00060496-B01
Product name: AASDHPPT MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human AASDHPPT protein.
Gene id: 60496
Gene name: AASDHPPT
Gene alias: AASD-PPT|CGI-80|DKFZp566E2346|LYS2|LYS5
Gene description: aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Genbank accession: NM_015423.2
Immunogen: AASDHPPT (NP_056238.2, 1 a.a. ~ 309 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Protein accession: NP_056238.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00060496-B01-13-15-1.jpg
Application image note: Western Blot analysis of AASDHPPT expression in transfected 293T cell line (H00060496-T01) by AASDHPPT MaxPab polyclonal antibody.

Lane 1: AASDHPPT transfected lysate(33.99 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AASDHPPT MaxPab mouse polyclonal antibody (B01) now

Add to cart