Brand: | Abnova |
Reference: | H00060489-A01 |
Product name: | APOBEC3G polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant APOBEC3G. |
Gene id: | 60489 |
Gene name: | APOBEC3G |
Gene alias: | ARP9|CEM15|FLJ12740|MDS019|bK150C2.7|dJ494G10.1 |
Gene description: | apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G |
Genbank accession: | NM_021822 |
Immunogen: | APOBEC3G (NP_068594, 80 a.a. ~ 181 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKY |
Protein accession: | NP_068594 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |