Brand: | Abnova |
Reference: | H00060485-M04 |
Product name: | SAV1 monoclonal antibody (M04), clone 3A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SAV1. |
Clone: | 3A10 |
Isotype: | IgG2a Kappa |
Gene id: | 60485 |
Gene name: | SAV1 |
Gene alias: | SAV|WW45|WWP4 |
Gene description: | salvador homolog 1 (Drosophila) |
Genbank accession: | NM_021818 |
Immunogen: | SAV1 (NP_068590, 300 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF |
Protein accession: | NP_068590 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.98 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SAV1 monoclonal antibody (M04), clone 3A10. Western Blot analysis of SAV1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |