SAV1 monoclonal antibody (M04), clone 3A10 View larger

SAV1 monoclonal antibody (M04), clone 3A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SAV1 monoclonal antibody (M04), clone 3A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about SAV1 monoclonal antibody (M04), clone 3A10

Brand: Abnova
Reference: H00060485-M04
Product name: SAV1 monoclonal antibody (M04), clone 3A10
Product description: Mouse monoclonal antibody raised against a partial recombinant SAV1.
Clone: 3A10
Isotype: IgG2a Kappa
Gene id: 60485
Gene name: SAV1
Gene alias: SAV|WW45|WWP4
Gene description: salvador homolog 1 (Drosophila)
Genbank accession: NM_021818
Immunogen: SAV1 (NP_068590, 300 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF
Protein accession: NP_068590
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060485-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.98 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060485-M04-1-25-1.jpg
Application image note: SAV1 monoclonal antibody (M04), clone 3A10. Western Blot analysis of SAV1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SAV1 monoclonal antibody (M04), clone 3A10 now

Add to cart