SAV1 monoclonal antibody (M02), clone 3B2 View larger

SAV1 monoclonal antibody (M02), clone 3B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SAV1 monoclonal antibody (M02), clone 3B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,IP

More info about SAV1 monoclonal antibody (M02), clone 3B2

Brand: Abnova
Reference: H00060485-M02
Product name: SAV1 monoclonal antibody (M02), clone 3B2
Product description: Mouse monoclonal antibody raised against a partial recombinant SAV1.
Clone: 3B2
Isotype: IgG2a Kappa
Gene id: 60485
Gene name: SAV1
Gene alias: SAV|WW45|WWP4
Gene description: salvador homolog 1 (Drosophila)
Genbank accession: NM_021818
Immunogen: SAV1 (NP_068590, 300 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF
Protein accession: NP_068590
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060485-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.98 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060485-M02-1-25-1.jpg
Application image note: SAV1 monoclonal antibody (M02), clone 3B2 Western Blot analysis of SAV1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice
Publications: Hippo signaling mediates proliferation, invasiveness and metastatic potential of clear cell renal cell carcinoma.Schutte U, Bisht S, Heukamp LC, Kebschull M, Florin A, Haarmann J, Hoffmann P, Bendas G, Buettner R, Brossart P, Feldmann G.
Translational Oncology Volume 7, Issue 2, April 2014, Pages 309–321

Reviews

Buy SAV1 monoclonal antibody (M02), clone 3B2 now

Add to cart