CDH26 monoclonal antibody (M04), clone 6C10 View larger

CDH26 monoclonal antibody (M04), clone 6C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDH26 monoclonal antibody (M04), clone 6C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about CDH26 monoclonal antibody (M04), clone 6C10

Brand: Abnova
Reference: H00060437-M04
Product name: CDH26 monoclonal antibody (M04), clone 6C10
Product description: Mouse monoclonal antibody raised against a full-length recombinant CDH26.
Clone: 6C10
Isotype: IgG2b Kappa
Gene id: 60437
Gene name: CDH26
Gene alias: VR20
Gene description: cadherin-like 26
Genbank accession: NM_021810.3
Immunogen: CDH26 (NP_068582.2, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKPLIWTWSDVEGQRPALLICTAAAGPTQGVKDLEEVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIHSTPAYPDATMHRQLLAPVEGRMAETLNQKLHVANVLEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQPDLLDSLGSKATPFEEIYSESGVPS
Protein accession: NP_068582.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060437-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (44.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060437-M04-1-1-1.jpg
Application image note: CDH26 monoclonal antibody (M04), clone 6C10. Western Blot analysis of CDH26 expression in HeLa.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDH26 monoclonal antibody (M04), clone 6C10 now

Add to cart