TGIF2 monoclonal antibody (M13A), clone 3G8 View larger

TGIF2 monoclonal antibody (M13A), clone 3G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TGIF2 monoclonal antibody (M13A), clone 3G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TGIF2 monoclonal antibody (M13A), clone 3G8

Brand: Abnova
Reference: H00060436-M13A
Product name: TGIF2 monoclonal antibody (M13A), clone 3G8
Product description: Mouse monoclonal antibody raised against a full-length recombinant TGIF2.
Clone: 3G8
Isotype: IgG2b Kappa
Gene id: 60436
Gene name: TGIF2
Gene alias: -
Gene description: TGFB-induced factor homeobox 2
Genbank accession: BC012816
Immunogen: TGIF2 (AAH12816, 1 a.a. ~ 237 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
Protein accession: AAH12816
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060436-M13A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (51.81 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TGIF2 monoclonal antibody (M13A), clone 3G8 now

Add to cart