TGIF2 monoclonal antibody (M06), clone 6A8 View larger

TGIF2 monoclonal antibody (M06), clone 6A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TGIF2 monoclonal antibody (M06), clone 6A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about TGIF2 monoclonal antibody (M06), clone 6A8

Brand: Abnova
Reference: H00060436-M06
Product name: TGIF2 monoclonal antibody (M06), clone 6A8
Product description: Mouse monoclonal antibody raised against a partial recombinant TGIF2.
Clone: 6A8
Isotype: IgG2a Kappa
Gene id: 60436
Gene name: TGIF2
Gene alias: -
Gene description: TGFB-induced factor homeobox 2
Genbank accession: NM_021809
Immunogen: TGIF2 (NP_068581, 131 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENP
Protein accession: NP_068581
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060436-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060436-M06-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TGIF2 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TGIF2 monoclonal antibody (M06), clone 6A8 now

Add to cart