Brand: | Abnova |
Reference: | H00060436-M06 |
Product name: | TGIF2 monoclonal antibody (M06), clone 6A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TGIF2. |
Clone: | 6A8 |
Isotype: | IgG2a Kappa |
Gene id: | 60436 |
Gene name: | TGIF2 |
Gene alias: | - |
Gene description: | TGFB-induced factor homeobox 2 |
Genbank accession: | NM_021809 |
Immunogen: | TGIF2 (NP_068581, 131 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENP |
Protein accession: | NP_068581 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to TGIF2 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |