EXOC4 monoclonal antibody (M06), clone 4F1 View larger

EXOC4 monoclonal antibody (M06), clone 4F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EXOC4 monoclonal antibody (M06), clone 4F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about EXOC4 monoclonal antibody (M06), clone 4F1

Brand: Abnova
Reference: H00060412-M06
Product name: EXOC4 monoclonal antibody (M06), clone 4F1
Product description: Mouse monoclonal antibody raised against a partial recombinant EXOC4.
Clone: 4F1
Isotype: IgG2a Kappa
Gene id: 60412
Gene name: EXOC4
Gene alias: MGC27170|REC8|SEC8|SEC8L1|Sec8p
Gene description: exocyst complex component 4
Genbank accession: NM_021807
Immunogen: EXOC4 (NP_068579, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRD
Protein accession: NP_068579
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060412-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00060412-M06-1-25-1.jpg
Application image note: EXOC4 monoclonal antibody (M06), clone 4F1 Western Blot analysis of EXOC4 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Exocyst subunits are involved in isoproterenol-induced amylase release from rat parotid acinar cells.Imai A, Yoshie S, Haga-Tsujimura M, Nashida T, Shimomura H.
Eur J Oral Sci. 2012 Apr;120(2):123-31. doi: 10.1111/j.1600-0722.2012.00952.x.

Reviews

Buy EXOC4 monoclonal antibody (M06), clone 4F1 now

Add to cart