EDA2R monoclonal antibody (M02), clone 3C1 View larger

EDA2R monoclonal antibody (M02), clone 3C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EDA2R monoclonal antibody (M02), clone 3C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about EDA2R monoclonal antibody (M02), clone 3C1

Brand: Abnova
Reference: H00060401-M02
Product name: EDA2R monoclonal antibody (M02), clone 3C1
Product description: Mouse monoclonal antibody raised against a partial recombinant EDA2R.
Clone: 3C1
Isotype: IgG1 Kappa
Gene id: 60401
Gene name: EDA2R
Gene alias: EDA-A2R|EDAA2R|TNFRSF27|XEDAR
Gene description: ectodysplasin A2 receptor
Genbank accession: NM_021783
Immunogen: EDA2R (NP_068555, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQ
Protein accession: NP_068555
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060401-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00060401-M02-1-27-1.jpg
Application image note: EDA2R monoclonal antibody (M02), clone 3C1. Western Blot analysis of EDA2R expression in Raw 264.7.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EDA2R monoclonal antibody (M02), clone 3C1 now

Add to cart