AVPI1 monoclonal antibody (M03), clone 1G3 View larger

AVPI1 monoclonal antibody (M03), clone 1G3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AVPI1 monoclonal antibody (M03), clone 1G3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about AVPI1 monoclonal antibody (M03), clone 1G3

Brand: Abnova
Reference: H00060370-M03
Product name: AVPI1 monoclonal antibody (M03), clone 1G3
Product description: Mouse monoclonal antibody raised against a full-length recombinant AVPI1.
Clone: 1G3
Isotype: IgG1 Kappa
Gene id: 60370
Gene name: AVPI1
Gene alias: PP5395|RP11-548K23.7|VIP32|VIT32
Gene description: arginine vasopressin-induced 1
Genbank accession: NM_021732.1
Immunogen: AVPI1 (NP_068378.1, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH
Protein accession: NP_068378.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00060370-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00060370-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged AVPI1 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AVPI1 monoclonal antibody (M03), clone 1G3 now

Add to cart