Brand: | Abnova |
Reference: | H00060370-M03 |
Product name: | AVPI1 monoclonal antibody (M03), clone 1G3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant AVPI1. |
Clone: | 1G3 |
Isotype: | IgG1 Kappa |
Gene id: | 60370 |
Gene name: | AVPI1 |
Gene alias: | PP5395|RP11-548K23.7|VIP32|VIT32 |
Gene description: | arginine vasopressin-induced 1 |
Genbank accession: | NM_021732.1 |
Immunogen: | AVPI1 (NP_068378.1, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH |
Protein accession: | NP_068378.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.2 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged AVPI1 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |