Brand: | Abnova |
Reference: | H00059348-M01 |
Product name: | ZNF350 monoclonal antibody (M01), clone 1A9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ZNF350. |
Clone: | 1A9 |
Isotype: | IgG2a Kappa |
Gene id: | 59348 |
Gene name: | ZNF350 |
Gene alias: | ZBRK1|ZFQR |
Gene description: | zinc finger protein 350 |
Genbank accession: | BC009921 |
Immunogen: | ZNF350 (AAH09921, 1 a.a. ~ 532 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQKLISTKSQFISPKHQKTRKLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCEKAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKHKRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP |
Protein accession: | AAH09921 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (84.26 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of ZNF350 transfected lysate using anti-ZNF350 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ZNF350 MaxPab rabbit polyclonal antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |