ZNF350 monoclonal antibody (M01), clone 1A9 View larger

ZNF350 monoclonal antibody (M01), clone 1A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF350 monoclonal antibody (M01), clone 1A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about ZNF350 monoclonal antibody (M01), clone 1A9

Brand: Abnova
Reference: H00059348-M01
Product name: ZNF350 monoclonal antibody (M01), clone 1A9
Product description: Mouse monoclonal antibody raised against a full-length recombinant ZNF350.
Clone: 1A9
Isotype: IgG2a Kappa
Gene id: 59348
Gene name: ZNF350
Gene alias: ZBRK1|ZFQR
Gene description: zinc finger protein 350
Genbank accession: BC009921
Immunogen: ZNF350 (AAH09921, 1 a.a. ~ 532 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQKLISTKSQFISPKHQKTRKLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCEKAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKHKRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP
Protein accession: AAH09921
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00059348-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (84.26 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00059348-M01-31-15-1.jpg
Application image note: Immunoprecipitation of ZNF350 transfected lysate using anti-ZNF350 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ZNF350 MaxPab rabbit polyclonal antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy ZNF350 monoclonal antibody (M01), clone 1A9 now

Add to cart