Brand: | Abnova |
Reference: | H00059341-M01 |
Product name: | TRPV4 monoclonal antibody (M01), clone 4E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRPV4. |
Clone: | 4E11 |
Isotype: | IgG2a Kappa |
Gene id: | 59341 |
Gene name: | TRPV4 |
Gene alias: | OTRPC4|TRP12|VR-OAC|VRL-2|VRL2|VROAC |
Gene description: | transient receptor potential cation channel, subfamily V, member 4 |
Genbank accession: | NM_021625.4 |
Immunogen: | TRPV4 (NP_067638.3, 772 a.a. ~ 871 a.a) partial recombinant protein with GST-pstS1 tag. |
Immunogen sequence/protein sequence: | PDRRWCFRVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDEVVVPLDSMGNPRCDGHQQGYPRKWRTDDAPL |
Protein accession: | NP_067638.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TRPV4 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |