Brand: | Abnova |
Reference: | H00059286-M01 |
Product name: | UBL5 monoclonal antibody (M01), clone 2F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBL5. |
Clone: | 2F7 |
Isotype: | IgG1 Kappa |
Gene id: | 59286 |
Gene name: | UBL5 |
Gene alias: | FLJ46917|HUB1|MGC131795 |
Gene description: | ubiquitin-like 5 |
Genbank accession: | NM_024292 |
Immunogen: | UBL5 (NP_077268, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ |
Protein accession: | NP_077268 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Human UBL5 protein interacts with coilin and meets the Cajal bodies.Surnamesveda G, Surnamecastoralova G, Surnamelipov G, Surnameruml G, Surnameknejzlik G Biochem Biophys Res Commun. 2013 May 30. pii: S0006-291X(13)00890-5. doi: 10.1016/j.bbrc.2013.05.083. |