CACNG7 monoclonal antibody (M01), clone 1F7 View larger

CACNG7 monoclonal antibody (M01), clone 1F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CACNG7 monoclonal antibody (M01), clone 1F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CACNG7 monoclonal antibody (M01), clone 1F7

Brand: Abnova
Reference: H00059284-M01
Product name: CACNG7 monoclonal antibody (M01), clone 1F7
Product description: Mouse monoclonal antibody raised against a partial recombinant CACNG7.
Clone: 1F7
Isotype: IgG1 Kappa
Gene id: 59284
Gene name: CACNG7
Gene alias: -
Gene description: calcium channel, voltage-dependent, gamma subunit 7
Genbank accession: NM_031896
Immunogen: CACNG7 (NP_114102.2, 203 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSP
Protein accession: NP_114102.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00059284-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.66 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00059284-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged CACNG7 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CACNG7 monoclonal antibody (M01), clone 1F7 now

Add to cart