IL22RA1 monoclonal antibody (M01), clone 2E6 View larger

IL22RA1 monoclonal antibody (M01), clone 2E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL22RA1 monoclonal antibody (M01), clone 2E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Tr

More info about IL22RA1 monoclonal antibody (M01), clone 2E6

Brand: Abnova
Reference: H00058985-M01
Product name: IL22RA1 monoclonal antibody (M01), clone 2E6
Product description: Mouse monoclonal antibody raised against a partial recombinant IL22RA1.
Clone: 2E6
Isotype: IgG2a Kappa
Gene id: 58985
Gene name: IL22RA1
Gene alias: CRF2-9|IL22R|IL22R1
Gene description: interleukin 22 receptor, alpha 1
Genbank accession: NM_021258
Immunogen: IL22RA1 (NP_067081, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMT
Protein accession: NP_067081
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058985-M01-13-15-1.jpg
Application image note: Western Blot analysis of IL22RA1 expression in transfected 293T cell line by IL22RA1 monoclonal antibody (M01), clone 2E6.

Lane 1: IL22RA1 transfected lysate (Predicted MW: 63.1 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IL22RA1 monoclonal antibody (M01), clone 2E6 now

Add to cart