C6orf115 monoclonal antibody (M01), clone 1G12-1D7 View larger

C6orf115 monoclonal antibody (M01), clone 1G12-1D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C6orf115 monoclonal antibody (M01), clone 1G12-1D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about C6orf115 monoclonal antibody (M01), clone 1G12-1D7

Brand: Abnova
Reference: H00058527-M01
Product name: C6orf115 monoclonal antibody (M01), clone 1G12-1D7
Product description: Mouse monoclonal antibody raised against a full length recombinant C6orf115.
Clone: 1G12-1D7
Isotype: IgG1 kappa
Gene id: 58527
Gene name: C6orf115
Gene alias: HSPC280|PRO2013
Gene description: chromosome 6 open reading frame 115
Genbank accession: BC014953
Immunogen: C6orf115 (AAH14953, 1 a.a. ~ 81 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD
Protein accession: AAH14953
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058527-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged C6orf115 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C6orf115 monoclonal antibody (M01), clone 1G12-1D7 now

Add to cart