MID1IP1 monoclonal antibody (M01), clone 8G8 View larger

MID1IP1 monoclonal antibody (M01), clone 8G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MID1IP1 monoclonal antibody (M01), clone 8G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about MID1IP1 monoclonal antibody (M01), clone 8G8

Brand: Abnova
Reference: H00058526-M01
Product name: MID1IP1 monoclonal antibody (M01), clone 8G8
Product description: Mouse monoclonal antibody raised against a full-length recombinant MID1IP1.
Clone: 8G8
Isotype: IgG1 Kappa
Gene id: 58526
Gene name: MID1IP1
Gene alias: FLJ10386|G12-like|MIG12|STRAIT11499|THRSPL
Gene description: MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish))
Genbank accession: NM_021242.3
Immunogen: MID1IP1 (NP_067065.1, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH
Protein accession: NP_067065.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058526-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.6 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058526-M01-13-15-1.jpg
Application image note: Western Blot analysis of MID1IP1 expression in transfected 293T cell line by MID1IP1 monoclonal antibody (M01), clone 8G8.

Lane 1: MID1IP1 transfected lysate (Predicted MW: 20.2 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MID1IP1 monoclonal antibody (M01), clone 8G8 now

Add to cart