Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00058526-M01 |
Product name: | MID1IP1 monoclonal antibody (M01), clone 8G8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MID1IP1. |
Clone: | 8G8 |
Isotype: | IgG1 Kappa |
Gene id: | 58526 |
Gene name: | MID1IP1 |
Gene alias: | FLJ10386|G12-like|MIG12|STRAIT11499|THRSPL |
Gene description: | MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) |
Genbank accession: | NM_021242.3 |
Immunogen: | MID1IP1 (NP_067065.1, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH |
Protein accession: | NP_067065.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (46.6 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MID1IP1 expression in transfected 293T cell line by MID1IP1 monoclonal antibody (M01), clone 8G8. Lane 1: MID1IP1 transfected lysate (Predicted MW: 20.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |