Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of JAM2 monoclonal antibody (M01), clone 1G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about JAM2 monoclonal antibody (M01), clone 1G4
| Brand: | Abnova |
| Reference: | H00058494-M01 |
| Product name: | JAM2 monoclonal antibody (M01), clone 1G4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant JAM2. |
| Clone: | 1G4 |
| Isotype: | IgG1 kappa |
| Gene id: | 58494 |
| Gene name: | JAM2 |
| Gene alias: | C21orf43|CD322|JAM-B|JAMB|PRO245|VE-JAM|VEJAM |
| Gene description: | junctional adhesion molecule 2 |
| Genbank accession: | BC017779 |
| Immunogen: | JAM2 (AAH17779, 29 a.a. ~ 298 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII |
| Protein accession: | AAH17779 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (55.44 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to JAM2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,WB-Ti,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |