ZNF71 monoclonal antibody (M01), clone 3F4 View larger

ZNF71 monoclonal antibody (M01), clone 3F4

H00058491-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF71 monoclonal antibody (M01), clone 3F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ZNF71 monoclonal antibody (M01), clone 3F4

Brand: Abnova
Reference: H00058491-M01
Product name: ZNF71 monoclonal antibody (M01), clone 3F4
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF71.
Clone: 3F4
Isotype: IgG2a Kappa
Gene id: 58491
Gene name: ZNF71
Gene alias: EZFIT
Gene description: zinc finger protein 71
Genbank accession: NM_021216
Immunogen: ZNF71 (NP_067039.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKELDPKNDISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRGDAGAEWEPLGIPQGNKLLGGSVPACHELKAFANQGCVLVPPRLDDPTEKG
Protein accession: NP_067039.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058491-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058491-M01-13-15-1.jpg
Application image note: Western Blot analysis of ZNF71 expression in transfected 293T cell line by ZNF71 monoclonal antibody (M01), clone 3F4.

Lane 1: ZNF71 transfected lysate(54.5 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF71 monoclonal antibody (M01), clone 3F4 now

Add to cart