ZNF71 purified MaxPab rabbit polyclonal antibody (D01P) View larger

ZNF71 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF71 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF,WB-Tr

More info about ZNF71 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00058491-D01P
Product name: ZNF71 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human ZNF71 protein.
Gene id: 58491
Gene name: ZNF71
Gene alias: EZFIT
Gene description: zinc finger protein 71
Genbank accession: NM_021216.3
Immunogen: ZNF71 (NP_067039.1, 1 a.a. ~ 489 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKELDPKNDISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRGDAGAEWEPLGIPQGNKLLGGSVPACHELKAFANQGCVLVPPRLDDPTEKGACPPVRRGKNFSSTSDLSKPPMPCEEKKTYDCSECGKAFSRSSSLIKHQRIHTGEKPFECDTCGKHFIERSSLTIHQRVHTGEKPYACGDCGKAFSQRMNLTVHQRTHTGEKPYVCDVCGKAFRKTSSLTQHERIHTGEKPYACGDCGKAFSQNMHLIVHQRTHTGEKPYVCPECGRAFSQNMHLTEHQRTHTGEKPYACKECGKAFNKSSSLTLHQRNHTGEKPYVCGECGKAFSQSSYLIQHQRFHIGVKPFECSECGKAFSKNSSLTQHQRIHTGEKPYECYICKKHFTGRSSLIVHQIVHTGEKPYVCGECGKAFSQSAYLIEHQRIHTGEKPYRCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIHT
Protein accession: NP_067039.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00058491-D01P-13-15-1.jpg
Application image note: Western Blot analysis of ZNF71 expression in transfected 293T cell line (H00058491-T01) by ZNF71 MaxPab polyclonal antibody.

Lane 1: ZNF71 transfected lysate(54.50 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF71 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart