PCTP monoclonal antibody (M03), clone 3A11 View larger

PCTP monoclonal antibody (M03), clone 3A11

H00058488-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCTP monoclonal antibody (M03), clone 3A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re

More info about PCTP monoclonal antibody (M03), clone 3A11

Brand: Abnova
Reference: H00058488-M03
Product name: PCTP monoclonal antibody (M03), clone 3A11
Product description: Mouse monoclonal antibody raised against a partial recombinant PCTP.
Clone: 3A11
Isotype: IgG2a Kappa
Gene id: 58488
Gene name: PCTP
Gene alias: STARD2
Gene description: phosphatidylcholine transfer protein
Genbank accession: NM_021213
Immunogen: PCTP (NP_067036, 106 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
Protein accession: NP_067036
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058488-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058488-M03-1-12-1.jpg
Application image note: PCTP monoclonal antibody (M03), clone 3A11 Western Blot analysis of PCTP expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCTP monoclonal antibody (M03), clone 3A11 now

Add to cart