PCTP monoclonal antibody (M01A), clone 1F9 View larger

PCTP monoclonal antibody (M01A), clone 1F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCTP monoclonal antibody (M01A), clone 1F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about PCTP monoclonal antibody (M01A), clone 1F9

Brand: Abnova
Reference: H00058488-M01A
Product name: PCTP monoclonal antibody (M01A), clone 1F9
Product description: Mouse monoclonal antibody raised against a full-length recombinant PCTP.
Clone: 1F9
Isotype: IgG2b Kappa
Gene id: 58488
Gene name: PCTP
Gene alias: STARD2
Gene description: phosphatidylcholine transfer protein
Genbank accession: BC012084
Immunogen: PCTP (AAH12084, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
Protein accession: AAH12084
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058488-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.28 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058488-M01A-1-9-1.jpg
Application image note: PCTP monoclonal antibody (M01A), clone 1F9 Western Blot analysis of PCTP expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PCTP monoclonal antibody (M01A), clone 1F9 now

Add to cart