Brand: | Abnova |
Reference: | H00058488-M01 |
Product name: | PCTP monoclonal antibody (M01), clone 1F9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PCTP. |
Clone: | 1F9 |
Isotype: | IgG2b Kappa |
Gene id: | 58488 |
Gene name: | PCTP |
Gene alias: | STARD2 |
Gene description: | phosphatidylcholine transfer protein |
Genbank accession: | BC012084 |
Immunogen: | PCTP (AAH12084, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT |
Protein accession: | AAH12084 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (49.28 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PCTP monoclonal antibody (M01), clone 1F9 Western Blot analysis of PCTP expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |