Brand: | Abnova |
Reference: | H00058478-M01 |
Product name: | MASA monoclonal antibody (M01), clone 3C1-1D5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MASA. |
Clone: | 3C1-1D5 |
Isotype: | IgG1 kappa |
Gene id: | 58478 |
Gene name: | ENOPH1 |
Gene alias: | DKFZp586M0524|E1|FLJ12594|MASA|MST145 |
Gene description: | enolase-phosphatase 1 |
Genbank accession: | BC001317 |
Immunogen: | MASA (AAH01317, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST |
Protein accession: | AAH01317 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.39 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MASA monoclonal antibody (M01), clone 3C1-1D5 Western Blot analysis of MASA expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |