MASA monoclonal antibody (M01), clone 3C1-1D5 View larger

MASA monoclonal antibody (M01), clone 3C1-1D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MASA monoclonal antibody (M01), clone 3C1-1D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about MASA monoclonal antibody (M01), clone 3C1-1D5

Brand: Abnova
Reference: H00058478-M01
Product name: MASA monoclonal antibody (M01), clone 3C1-1D5
Product description: Mouse monoclonal antibody raised against a full length recombinant MASA.
Clone: 3C1-1D5
Isotype: IgG1 kappa
Gene id: 58478
Gene name: ENOPH1
Gene alias: DKFZp586M0524|E1|FLJ12594|MASA|MST145
Gene description: enolase-phosphatase 1
Genbank accession: BC001317
Immunogen: MASA (AAH01317, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
Protein accession: AAH01317
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058478-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.39 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058478-M01-1-2-1.jpg
Application image note: MASA monoclonal antibody (M01), clone 3C1-1D5 Western Blot analysis of MASA expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MASA monoclonal antibody (M01), clone 3C1-1D5 now

Add to cart