> >>ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)
ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,IF,WB-Tr

More info about ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00058478-D01P
Product name: ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human ENOPH1 protein.
Gene id: 58478
Gene name: ENOPH1
Gene alias: DKFZp586M0524|E1|FLJ12594|MASA|MST145
Gene description: enolase-phosphatase 1
Genbank accession: NM_021204
Immunogen: ENOPH1 (NP_067027.1, 1 a.a. ~ 261 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
Protein accession: NP_067027.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00058478-D01P-2-A2-1.jpg
Application image note: ENOPH1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ENOPH1 expression in human colon.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ENOPH1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart