MS4A7 monoclonal antibody (M06), clone 2D3 View larger

MS4A7 monoclonal antibody (M06), clone 2D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MS4A7 monoclonal antibody (M06), clone 2D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about MS4A7 monoclonal antibody (M06), clone 2D3

Brand: Abnova
Reference: H00058475-M06
Product name: MS4A7 monoclonal antibody (M06), clone 2D3
Product description: Mouse monoclonal antibody raised against a full length recombinant MS4A7.
Clone: 2D3
Isotype: IgG2b Kappa
Gene id: 58475
Gene name: MS4A7
Gene alias: 4SPAN2|CD20L4|CFFM4|MGC22368|MS4A8
Gene description: membrane-spanning 4-domains, subfamily A, member 7
Genbank accession: BC020673
Immunogen: MS4A7 (AAH20673, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
Protein accession: AAH20673
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058475-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (52.14 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058475-M06-42-R01V-1.jpg
Application image note: Western blot analysis of MS4A7 over-expressed 293 cell line, cotransfected with MS4A7 Validated Chimera RNAi ( Cat # H00058475-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MS4A7 monoclonal antibody (M06), clone 2D3 (Cat # H00058475-M06 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy MS4A7 monoclonal antibody (M06), clone 2D3 now

Add to cart