CXCL16 monoclonal antibody (M02), clone 1F1 View larger

CXCL16 monoclonal antibody (M02), clone 1F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CXCL16 monoclonal antibody (M02), clone 1F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CXCL16 monoclonal antibody (M02), clone 1F1

Brand: Abnova
Reference: H00058191-M02
Product name: CXCL16 monoclonal antibody (M02), clone 1F1
Product description: Mouse monoclonal antibody raised against a full-length recombinant CXCL16.
Clone: 1F1
Isotype: IgG2b Kappa
Gene id: 58191
Gene name: CXCL16
Gene alias: CXCLG16|SR-PSOX|SRPSOX
Gene description: chemokine (C-X-C motif) ligand 16
Genbank accession: BC017588
Immunogen: CXCL16 (AAH17588, 49 a.a. ~ 273 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT
Protein accession: AAH17588
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058191-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50.49 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058191-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged CXCL16 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CXCL16 monoclonal antibody (M02), clone 1F1 now

Add to cart