NGB monoclonal antibody (M01), clone 2B5-A7 View larger

NGB monoclonal antibody (M01), clone 2B5-A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NGB monoclonal antibody (M01), clone 2B5-A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NGB monoclonal antibody (M01), clone 2B5-A7

Brand: Abnova
Reference: H00058157-M01
Product name: NGB monoclonal antibody (M01), clone 2B5-A7
Product description: Mouse monoclonal antibody raised against a full length recombinant NGB.
Clone: 2B5-A7
Isotype: IgG1 kappa
Gene id: 58157
Gene name: NGB
Gene alias: -
Gene description: neuroglobin
Genbank accession: BC032509
Immunogen: NGB (AAH32509, 1 a.a. ~ 151 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MERPEPELIRQSWRAVSRSPLGHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Protein accession: AAH32509
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058157-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.35 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00058157-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged NGB is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NGB monoclonal antibody (M01), clone 2B5-A7 now

Add to cart