Brand: | Abnova |
Reference: | H00058155-M09 |
Product name: | PTBP2 monoclonal antibody (M09), clone 2B11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTBP2. |
Clone: | 2B11 |
Isotype: | IgG2a Kappa |
Gene id: | 58155 |
Gene name: | PTBP2 |
Gene alias: | FLJ34897|PTB|PTBLP|brPTB|nPTB|nPTB5|nPTB6|nPTB7|nPTB8 |
Gene description: | polypyrimidine tract binding protein 2 |
Genbank accession: | BC016582 |
Immunogen: | PTBP2 (AAH16582.1, 35 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTP |
Protein accession: | AAH16582.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (41.25 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Specificity: | This antibody cross-reacts with human PTBP1. |
Reactivity: | Human |
Application image: |  |
Application image note: | PTBP2 monoclonal antibody (M09), clone 2B11. Western Blot analysis of PTBP2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |