PTBP2 monoclonal antibody (M09), clone 2B11 View larger

PTBP2 monoclonal antibody (M09), clone 2B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTBP2 monoclonal antibody (M09), clone 2B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about PTBP2 monoclonal antibody (M09), clone 2B11

Brand: Abnova
Reference: H00058155-M09
Product name: PTBP2 monoclonal antibody (M09), clone 2B11
Product description: Mouse monoclonal antibody raised against a partial recombinant PTBP2.
Clone: 2B11
Isotype: IgG2a Kappa
Gene id: 58155
Gene name: PTBP2
Gene alias: FLJ34897|PTB|PTBLP|brPTB|nPTB|nPTB5|nPTB6|nPTB7|nPTB8
Gene description: polypyrimidine tract binding protein 2
Genbank accession: BC016582
Immunogen: PTBP2 (AAH16582.1, 35 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVVTANGNDSKKFKGEDKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLELATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTP
Protein accession: AAH16582.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00058155-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.25 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Specificity: This antibody cross-reacts with human PTBP1.
Reactivity: Human
Application image: H00058155-M09-1-25-1.jpg
Application image note: PTBP2 monoclonal antibody (M09), clone 2B11. Western Blot analysis of PTBP2 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PTBP2 monoclonal antibody (M09), clone 2B11 now

Add to cart