TSCOT monoclonal antibody (M06), clone 2F7 View larger

TSCOT monoclonal antibody (M06), clone 2F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSCOT monoclonal antibody (M06), clone 2F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TSCOT monoclonal antibody (M06), clone 2F7

Brand: Abnova
Reference: H00057864-M06
Product name: TSCOT monoclonal antibody (M06), clone 2F7
Product description: Mouse monoclonal antibody raised against a partial recombinant TSCOT.
Clone: 2F7
Isotype: IgG2a Kappa
Gene id: 57864
Gene name: SLC46A2
Gene alias: Ly110|TSCOT
Gene description: solute carrier family 46, member 2
Genbank accession: NM_033051
Immunogen: TSCOT (NP_149040, 227 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTT
Protein accession: NP_149040
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00057864-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057864-M06-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SLC46A2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TSCOT monoclonal antibody (M06), clone 2F7 now

Add to cart