Brand: | Abnova |
Reference: | H00057864-M06 |
Product name: | TSCOT monoclonal antibody (M06), clone 2F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TSCOT. |
Clone: | 2F7 |
Isotype: | IgG2a Kappa |
Gene id: | 57864 |
Gene name: | SLC46A2 |
Gene alias: | Ly110|TSCOT |
Gene description: | solute carrier family 46, member 2 |
Genbank accession: | NM_033051 |
Immunogen: | TSCOT (NP_149040, 227 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTT |
Protein accession: | NP_149040 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC46A2 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |