SLAMF7 monoclonal antibody (M01), clone 1B9 View larger

SLAMF7 monoclonal antibody (M01), clone 1B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLAMF7 monoclonal antibody (M01), clone 1B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about SLAMF7 monoclonal antibody (M01), clone 1B9

Brand: Abnova
Reference: H00057823-M01
Product name: SLAMF7 monoclonal antibody (M01), clone 1B9
Product description: Mouse monoclonal antibody raised against a full-length recombinant SLAMF7.
Clone: 1B9
Isotype: IgG1 Kappa
Gene id: 57823
Gene name: SLAMF7
Gene alias: 19A|CD319|CRACC|CS1
Gene description: SLAM family member 7
Genbank accession: BC027867
Immunogen: SLAMF7 (AAH27867, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLPLVPLLLSLFVLGLFLWFLKRERQEENNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAICL
Protein accession: AAH27867
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00057823-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged SLAMF7 is 1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice
Publications: Development and Validation of Electrochemiluminescence Assays to Measure Free and Total sSLAMF7 in Human Serum in the Absence and Presence of Elotuzumab.Postelnek J, Neely RJ, Robbins MD, Gleason CR, Peterson JE, Piccoli SP.
AAPS J. 2016 Apr 26. [Epub ahead of print]

Reviews

Buy SLAMF7 monoclonal antibody (M01), clone 1B9 now

Add to cart