Brand: | Abnova |
Reference: | H00057823-M01 |
Product name: | SLAMF7 monoclonal antibody (M01), clone 1B9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SLAMF7. |
Clone: | 1B9 |
Isotype: | IgG1 Kappa |
Gene id: | 57823 |
Gene name: | SLAMF7 |
Gene alias: | 19A|CD319|CRACC|CS1 |
Gene description: | SLAM family member 7 |
Genbank accession: | BC027867 |
Immunogen: | SLAMF7 (AAH27867, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLPLVPLLLSLFVLGLFLWFLKRERQEENNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAICL |
Protein accession: | AAH27867 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLAMF7 is 1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |
Publications: | Development and Validation of Electrochemiluminescence Assays to Measure Free and Total sSLAMF7 in Human Serum in the Absence and Presence of Elotuzumab.Postelnek J, Neely RJ, Robbins MD, Gleason CR, Peterson JE, Piccoli SP. AAPS J. 2016 Apr 26. [Epub ahead of print] |